GLP-2 (Glucagon-Like Peptide-2) is a 33-amino acid research peptide studied for its role in regulating intestinal epithelial growth, maintaining mucosal integrity, and modulating nutrient absorption processes.
$700.00
GLP-2 (Glucagon-Like Peptide-2) – Research Peptide
GLP-2 (Glucagon-Like Peptide-2) is a 33-amino acid peptide derived from proglucagon. It is primarily expressed in the intestinal endocrine cells and has been shown in research models to regulate intestinal growth, enhance mucosal integrity, and modulate digestive function.
In experimental settings, GLP-2 is studied for its ability to influence gastrointestinal tissues, particularly its role in promoting epithelial cell proliferation and reducing intestinal permeability. It is also used to explore signaling pathways related to gut function and nutrient transport.
Molecular Formula: C₁₆₆H₂₅₁N₄₇O₅₁
Molecular Weight: 3751.99 g/mol
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Research Applications:
Investigation of intestinal epithelial dynamics
Studies on gastrointestinal barrier function
Exploration of nutrient transport mechanisms
Research into gut-associated signaling pathways
Our mission is to provide high-quality, innovative peptides and research products that empower scientific discovery and advancement. We are committed to offering reliable, cutting-edge solutions for researchers in the fields of biology, biochemistry, and molecular science. By supporting rigorous scientific research, we aim to foster breakthroughs in a wide range of applications, from cellular biology to therapeutic research, enabling the progress of scientific knowledge for a better understanding of life at the molecular level.
Disclaimer: Our peptides and proteins are for research purposes only and are not intended for human or animal consumption. They are not intended to diagnose, treat, cure, or prevent any disease or medical condition. It is the responsibility of the purchaser to determine the suitability of our peptides and proteins for their intended use. Our peptides and proteins are sold strictly for research and laboratory use, and all users must comply with all applicable laws and regulations regarding the use, handling, and disposal of these products. We do not make any warranties or representations regarding the accuracy, completeness, or usefulness of any information provided with our products, and we disclaim all liability for any damages arising from the use of our peptides and proteins.
All products on this site are for Research, Development use only. Products are Not for Human consumption of any kind. The statements made within this website have not been evaluated by the US Food and Drug Administration. The statements and the products of this company are not intended to diagnose, treat, cure or prevent any disease.
